Residual moisture is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2025-11-02. Where a claim depends on a specific study, the study is described rather than over-claimed.
Quality control for lyophilized materials includes visual inspection, residual moisture measurement, and reconstitution testing. Cake appearance can reveal process problems such as collapse, shrinkage, or meltback, although appearance alone does not prove potency. Residual moisture is commonly measured by Karl Fischer titration or by loss on drying. Reconstitution time is checked because a slow or incomplete dissolve can indicate a change in pore structure. Stability studies track these attributes over time under defined temperature and humidity conditions.
Analytical methods for lyophilized solids must account for the low moisture content and the fragile cake. Karl Fischer titration is widely used for water content, while near-infrared spectroscopy can measure moisture non-destructively in sealed containers. X-ray diffraction and modulated differential scanning calorimetry help identify crystalline or amorphous phases. Residual solvent analysis may be needed if organic solvents were used during formulation. The combination of these methods supports batch release and long-term stability assessment.
Regulatory expectations for lyophilized products focus on consistent manufacture and documented stability. Batches are often monitored for moisture, appearance, potency, and sterility where applicable. Process parameters such as shelf temperature, chamber pressure, and drying time are recorded and controlled within validated ranges. Open questions remain about how best to predict long-term stability from short accelerated studies, especially for complex biologics. Variations in freezing rate and ice crystal size can produce differences that are not always visible but may affect performance.
After drying, a lyophilized product is usually sealed under vacuum or an inert gas to limit moisture uptake. Residual water content is measured because small changes can alter chemical stability and cake appearance. Storage temperature depends on the material; many biological products are kept at 2–8 °C, while some require −20 °C or colder. Exposure to ambient humidity during handling can cause the porous solid to absorb water and collapse. Container closures and stoppers are therefore selected for low moisture transmission and compatibility.
| Property | Value | Notes |
|---|---|---|
| Storage temperature | 2–8 °C or 20–25 °C | Depends on product stability; some require frozen storage. |
| Moisture content | 0.5–3% w/w | Higher values may reduce stability; target set per product. |
| Moisture method | Karl Fischer titration | Coulometric for low levels; volumetric for higher levels. |
| Cake appearance | Uniform, intact, no collapse | Visual inspection is qualitative and not a potency measure. |
| Reconstitution time | Seconds to several minutes | Depends on cake density, excipients, and diluent. |
Stability programs monitor lyophilized products under defined temperature and humidity conditions over time. Real-time studies at recommended storage conditions are the reference, while accelerated studies provide early signals of degradation pathways. Because a dry cake can still undergo oxidation, hydrolysis, or aggregation, stability depends on residual moisture, excipients, and container headspace. Open questions include how best to predict long-term stability from short accelerated runs and how vial-to-vial variability affects shelf life. Current guidance treats these predictions as product-specific rather than universally generalizable.
Freeze-dried materials are hygroscopic to varying degrees and can take up moisture after drying. Storage therefore often uses sealed glass vials, rubber stoppers, and crimp seals to limit contact with ambient humidity. A desiccant may be included for moisture-sensitive products, although it is not universal. Controlled room temperature is sufficient for many lyophilizates, while others require refrigeration or freezing. Moisture ingress remains a primary cause of cake collapse, chemical degradation, and loss of reconstitution performance.
Quality control also examines cake structure, color, and reconstitution behavior. A collapsed or shrunken cake can indicate a thermal excursion during drying. Analytical methods such as X-ray diffraction, differential scanning calorimetry, and near-infrared spectroscopy can detect crystallinity or moisture distribution. Regulatory expectations focus on validated assays and lot-to-lot consistency. Questions remain about how well accelerated stability tests predict long-term behavior for every formulation. Visual inspection remains common but is subjective without trained reviewers and reference images.
After lyophilization, a product's quality depends on residual moisture, cake appearance, and reconstitution time. Residual moisture is often measured by Karl Fischer titration or thermogravimetric analysis. A low moisture content can slow chemical degradation, but overly dry cakes may be brittle or slow to dissolve. Stability studies track these attributes over months under defined temperature and humidity conditions. Batch records link these measurements to specific process runs and help identify trends before a product fails specification.
Storage conditions for dried products usually aim to exclude moisture and oxygen. Vials are sealed under vacuum or with an inert gas, and stoppers must maintain a barrier during transport. Temperature recommendations vary; some materials remain stable at room temperature, while others need refrigeration or frozen storage. Humidity control is critical because dried cakes can absorb water rapidly once a container is opened. Desiccant packs and moisture-barrier bags add further protection during shipping.
Quality control for lyophilized products includes appearance, cake structure, reconstitution time, pH, residual moisture, and potency. Residual moisture is a key attribute because excess water can reduce stability, while excessively low moisture may cause structural changes or aggregation in some systems. Stability studies compare real-time and accelerated conditions to estimate shelf life. Analytical methods must be validated for the specific matrix, container, and moisture range. Sterility and container integrity are also monitored for sterile products.
Handling practices aim to prevent moisture ingress and mechanical damage. Vials should remain stoppered and crimped until use, and reconstitution should follow the labeled diluent and volume. Shipping may involve temperature-controlled containers and desiccants, but direct contact between desiccant and product is avoided. Regulatory guidance expects documented storage conditions, excursion assessments, and stability commitments. Open questions remain about how best to predict long-term stability from short accelerated studies for every formulation class.
After lyophilization, the product is usually a porous cake or powder with a large internal surface area. This structure can absorb moisture quickly if exposed to humid air, so vials are sealed under vacuum or an inert gas. Moisture uptake may lower the glass transition temperature of the dried matrix and accelerate chemical or physical degradation. Storage conditions therefore depend on the formulation, container, and intended shelf life. Some products remain stable at room temperature, while others require refrigeration or freezing.
It is doubtful whether the Northern Hemisphere fossil species of Ginkgo can be reliably distinguished. Given the slow pace of evolution and morphological similarity between members of the genus, there may have been only one or two species existing in the Northern Hemisphere through the entirety of the Cenozoic: present-day G. biloba (including G. adiantoides) and G. gardneri from the Paleocene of Scotland. At least morphologically, G. gardneri and the Southern Hemisphere species are the only known post-Jurassic taxa that can be unequivocally recognised. The remainder may have been ecotypes or subspecies. The implications would be that G. biloba had occurred over an extremely wide range, had remarkable genetic flexibility and, though evolving genetically, never showed much speciation. While it may seem improbable that a single species may exist as a contiguous entity for many millions of years, many of the ginkgo's life-history parameters fit: Extreme longevity; slow reproduction rate; (in Cenozoic and later times) a wide, apparently contiguous, but steadily contracting distribution; and (as far as can be demonstrated from the fossil record) extreme ecological conservatism (restriction to disturbed streamside environments).
Troponin, or the troponin complex, is a complex of three subunits of specialized regulatory proteins –troponin C, troponin I, and troponin T, that are components of the contraction mechanism in striated muscle. Measurements of cardiac-specific troponins I and T are extensively used as diagnostic and prognostic indicators in the management of myocarditis, myocardial infarction and acute coronary syndrome. Blood levels of cardiac troponin (cTn) may be used as a diagnostic marker for stroke or other myocardial injury that is ongoing, although the sensitivity of this measurement is low.
News of UDI was generally received calmly by the local citizenry, apart from some isolated incidents of passing cars being stoned in the black townships outside Bulawayo. A few expected dissenters were arrested, most prominently Leo Baron, Nkomo's lawyer, whose links with black Rhodesians and communists were seen by authorities as "subversive". Baron, the younger brother of the scientist Jacob Bronowski, was arrested nine minutes after UDI was made.
This allows it to take up water from concentrated solutions, including ammonium nitrate deposits, explaining its success in both nitrogen-polluted urban areas and coastal or dry Mediterranean climates where nitrogen levels are low.
Pseudoephedrine is a sympathomimetic and is well known for shrinking swollen nasal mucous membranes, so it is often used as a decongestant. It reduces tissue hyperemia, edema, and nasal congestion commonly associated with colds or allergies. Other beneficial effects may include increasing the drainage of sinus secretions, and opening of obstructed Eustachian tubes. The same vasoconstriction action can also result in hypertension, which is a noted side effect of pseudoephedrine. Pseudoephedrine can be used either as oral or as topical decongestant. Due to its stimulating qualities, however, the oral preparation is more likely to cause adverse effects, including urinary retention. According to one study, pseudoephedrine may show effectiveness as an antitussive drug (suppression of cough). Pseudoephedrine is indicated for the treatment of nasal congestion, sinus congestion, and Eustachian tube congestion. Pseudoephedrine is also indicated for vasomotor rhinitis and as an adjunct to other agents in the optimum treatment of allergic rhinitis, croup, sinusitis, otitis media, and tracheobronchitis.
Sources: en.wikipedia.org
After synthesizing and purifying the core, the carbohydrate layer is added to its surface. Common coating materials are typically polyhydroxy oligomers such as cellobiose, citrate, lactose, and sucrose. This layer seems to be important for the properties of aquasomes, as it influences several drug characteristics including adsorption, molecular stability, and conformation (shape), and acts as a dehydroprotectant. The addition of the carbohydrate layer to the surface of the nanocrystalline core is commonly carried out by passive adsorption through incubation and sonication. Similar to the processing of the core, the carbohydrate layer is subjected to centrifugation, washing, and further sonification followed by heated air drying. Finally, the bioactive molecule of interest is loaded into the carbohydrate layer. This process typically occurs through either lyophilization or passive adsorption, and the fully functionalized aquasome is then characterized.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Development of self-glowing actinide-doped materials with durable crystalline matrices is a new area of actinide utilization as the addition of alpha-emitting radionuclides to some glasses and crystals may confer luminescence.
Rett syndrome and fragile X syndrome (FXS) are single gene disorders related to autism with overlapping symptoms that include deficient neurological development, impaired language and communication, difficulties in social interactions, and stereotyped hand gestures. It is not uncommon for a patient to be diagnosed with both autism and Rett syndrome or FXS. Epigenetic regulatory mechanisms play the central role in pathogenesis of these two disorders. Genomic imprinting may also contribute to the development of autism. Genomic imprinting is another example of epigenetic regulation of gene expression. In this instance, the epigenetic modification(s) causes the offspring to express the maternal copy of a gene or the paternal copy of a gene, but not both. The imprinted gene is silenced through epigenetic mechanisms. Candidate genes and susceptibility alleles for autism are identified using a combination of techniques, including genome-wide and targeted analyses of allele sharing in sib-pairs, using association studies and transmission disequilibrium testing (TDT) of functional or positional candidate genes and examination of novel and recurrent cytogenetic aberrations. Results from numerous studies have identified several genomic regions known to be subject to imprinting, candidate genes, and gene-environment interactions. Particularly, chromosomes 15q and 7q appear to be epigenetic hotspots in contributing to autism. Also, genes on the X chromosome may play an important role, as in Rett syndrome.
Iguarán scored twice in a 2–0 win over Ecuador in Barranquilla on 20 August, and after a 2–1 defeat in Asunción — conceded to a stoppage-time penalty from the debutant José Luis Chilavert — and a goalless draw in Guayaquil, Colombia beat Paraguay 2–1 in Barranquilla through Iguarán and Rubén Hernández. Ecuador's 3–1 win over Paraguay on 24 September confirmed Colombia as group winners and sent them to an intercontinental play-off. Against Israel, winners of the Oceania group, Usuriaga scored the only goal of the first leg in Barranquilla on 15 October before 65,000 spectators. A goalless draw at the Ramat Gan Stadium in Tel Aviv on 30 October 1989 completed a 1–0 aggregate victory and returned Colombia to the World Cup after an absence of 28 years.
Sources: en.wikipedia.org
=== Soundproofing === Researchers demonstrated a graphene-oxide-based aerogel that could reduce noise by up to 16 decibels. The aerogel weighed 2.1 kilograms per cubic metre (0.13 lb/cu ft). A conventional polyester urethane sound absorber might weigh 32 kilograms per cubic metre (2.0 lb/cu ft). One possible application is to reduce sound levels in airplane cabins.
== Discovery == An in silico search for potential small open-reading-frames (sORFs) within 16S ribosomal RNA-encoding short peptides (20–40 amino acids) was conducted in the Pinchas Cohen lab at University of Southern California. Six sequences encoding 20–38 amino-acid-long peptides were identified, which were named SHLP 1–6. The endogenous SHLPs were detected by immunoblots and their transcripts were validated by both qPCR and northern blot.
718 Other derangement of joint 718.0 Articular cartilage disorder 718.1 Loose body in joint 718.2 Pathological dislocation 718.3 Recurrent dislocation of joint 718.4 Contracture of joint 718.5 Ankylosis of joint 718.6 Unspecified intrapelvic protrusion of acetabulum 718.7 Developmental dislocation of joint 719 Other and unspecified disorders of joint 719.0 Effusion/swelling of joint, unspec. 719.1 Hemarthrosis 719.2 Villonodular synovitis 719.3 Palindromic rheumatism 719.4 Joint pain, unspec. 719.5 Stiffness of joint 719.7 Difficulty in walking
Therefore, typical PMF samples are isolated proteins from two-dimensional gel electrophoresis (2D gels) or isolated SDS-PAGE bands. Additional analyses by MS/MS can either be direct, e.g., MALDI-TOF/TOF analysis or downstream nanoLC-ESI-MS/MS analysis of gel spot eluates.
Since 2021, China has faced a property sector crisis, with decreasing house prices, shrinking of the real estate sector and bankruptcies of many property developers, partially as a result of Xi's efforts to decrease the sector's role in the Chinese economy. Xi has heavily emphasized the role of advanced manufacturing and technology development to drive China's future economic growth. Since shortly after taking office as General Secretary, Xi emphasised the use of industrial policy to increase domestic innovation and reduce reliance on foreign technology. In 2015, Xi's administration launched the Double First-Class Construction, a higher education development and sponsorship scheme intended to replace the previous programs Project 211 and Project 985. Xi's administration has promoted Made in China 2025 plan that aims to make China self-reliant in key technologies; although publicly China de-emphasised this plan due to the outbreak of a China–United States trade war, majority of its goals were considered achieved by 2024. Since the outbreak of the trade war in 2018, Xi has further pushed calls for "self-reliance", especially on technology. China's domestic spending on R&D has significantly increased, surpassing the European Union (EU) and reaching a record $564 billion in 2020. The Chinese government has supported technology companies like Huawei through grants, tax breaks, credit facilities and other assistance, enabling their rise, leading to US countermeasures.
Sources: en.wikipedia.org
Most lyophilized products are stored in sealed containers at controlled temperature and humidity. Some require refrigeration, while others are stable at room temperature. Protection from light and moisture is often necessary.
Cake collapse indicates that the porous structure was lost during drying. It can result from excessive product temperature or an unsuitable formulation. Collapsed cakes may have slower reconstitution and are often rejected by visual inspection.
Residual moisture affects the chemical and physical stability of a lyophilized solid. High moisture can promote degradation, aggregation, or cake shrinkage. The acceptable range is set for each product based on stability data.
Most are held in sealed containers at controlled temperatures, often 2–8 °C, while some require frozen storage. Protection from moisture and light helps preserve the dry matrix. Exact conditions are set by the manufacturer or study protocol.