The short version of primary drying fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2026-03-05 and is reviewed periodically as new material appears.
Freeze-drying is distinct from simple evaporation and from spray drying. Evaporation removes water at temperatures above freezing, while spray drying rapidly dries droplets in a heated gas stream. Lyophilization avoids high temperatures, which can be useful for heat-sensitive materials such as proteins, vaccines, and some foods. The porous cake produced by sublimation dissolves or rehydrates more quickly than a dense dried mass. Not all materials tolerate freezing or the pH shifts that can occur as solutes concentrate during ice formation.
Lyophilization removes water from a frozen material by sublimation under reduced pressure. The process begins with freezing, which converts liquid water into ice and fixes the structure of the sample. After freezing, primary drying lowers pressure so ice changes directly to vapor without passing through a liquid phase. Secondary drying then removes bound water that remains after ice sublimation. The result is a dry, porous solid that often retains its original shape.
The low pressure used during drying allows water vapor to move from the ice surface to a cold condenser. Energy supplied as heat drives sublimation but must stay below the collapse temperature of the frozen matrix. If the product becomes too warm, the frozen structure may soften or melt, reducing pore formation and slowing drying. Formulations often include bulking agents, stabilizers, or buffers to support a rigid cake. The final moisture content depends on formulation, freezing rate, and the length of secondary drying.
In practice, lyophilization is slower and more energy intensive than simple drying. Cycle times can range from hours to several days depending on load, container, and formulation. Amorphous materials may require excipients that help preserve structure during freezing and drying. The method is widely used for biological materials, pharmaceuticals, and foods where heat drying would cause unacceptable change. Open questions remain about scaling cycles between laboratory and production equipment, and this gap affects technology transfer.
Lyophilization removes water by freezing a material and then lowering pressure so ice changes directly to vapor. The process relies on sublimation, the phase transition from solid to gas without an intermediate liquid state. Because the material remains frozen during primary drying, the structure often stays porous. This porous matrix can rehydrate quickly when water is added back. The low pressure also allows vapor to leave the solid matrix without boiling.
| Property | Value | Notes |
|---|---|---|
| Primary phase change | Sublimation | Ice changes directly to vapor under reduced pressure |
| Typical chamber pressure | 0.01–0.5 mbar (1–50 Pa) | Below the triple point of water; product-specific |
| Typical product temperature during primary drying | −40 °C to −10 °C | Kept below collapse temperature |
| Typical residual moisture | 0.5–3% w/w | Target range varies by formulation and use |
| Common synonyms | Freeze-drying; lyophilisation | Lyophilization is the US spelling |
The process relies on the phase diagram of water, where the triple point marks the conditions at which ice, liquid water, and vapor coexist. By maintaining pressure below this point, typically around 0.01 to 0.1 millibar, sublimation becomes the dominant mechanism. Formulations often include excipients such as sugars or polymers that act as lyoprotectants and bulking agents. These additives help preserve the structure of the active ingredient and prevent collapse during drying. The choice of excipient and freezing rate influences the final cake morphology and stability.
Industries use lyophilization for pharmaceuticals, biological products, and food preservation. In the pharmaceutical sector, it extends the shelf life of injectable drugs, vaccines, and proteins that are unstable in aqueous solution. Food manufacturers apply freeze-drying to coffee, fruits, and ready meals to retain flavor and texture. The process is energy-intensive and requires specialized equipment, which limits its use to high-value products. Ongoing research examines how formulation and process parameters affect the quality of the final dried product.
Lyophilization, also known as freeze-drying, is a process that removes water from a material by freezing it and then reducing pressure to allow ice to sublimate directly into vapor. The method begins with a freezing step that solidifies the water content. Next, primary drying lowers the pressure below the triple point of water, enabling sublimation without passing through a liquid phase. A final secondary drying step removes bound water through desorption. This sequence produces a dry, porous cake that can be reconstituted later.
Equipment for lyophilization includes a vacuum chamber, temperature-controlled shelves, a condenser, and a vacuum pump. A refrigeration system cools the shelves and condenser below the product's freezing point. Process monitoring often uses Pirani and capacitance manometers, thermocouples, and resistance sensors. Cycle development balances product quality with time and energy use. Some products are annealed during freezing to improve crystallization of bulking agents. Open questions remain about scaling cycles between laboratory, pilot, and production freeze-dryers.
Lyophilization, also called freeze-drying, removes water from a frozen material by sublimation under reduced pressure. The process begins with freezing, which converts free water into ice and may also produce a glassy phase. Primary drying then lowers chamber pressure so ice sublimes directly to vapor without passing through a liquid stage. Secondary drying raises the temperature modestly to remove bound water. The result is a porous, dry solid that usually reconstitutes quickly. Each stage influences pore structure, residual moisture, and stability.
In its 2018 Gen Z Music Consumption & Spending Report, digital media company Sweety High found that Generation Z was listening to more diverse music genres than generations past, whose music preferences solidified by early adolescence. Spotify was the most popular source of music for Generation Z (61%), followed by terrestrial radio ranked second (55%), while YouTube was the preferred platform for music discovery (75%). TikTok is another major platform for music discovery and for Generation Z to connect with their favorite musicians. Research on popular music from the 1950s to the 2010s has shown that this genre has become louder, while the chords, melodies, and types of sounds used have becoming increasingly homogenized. At the same time, lyrics of the most popular songs have becoming less joyful, sadder, and angrier. Such shifts have occurred due to changing consumer tastes. In particular, the melancholic lyrics of Billie Eilish and Olivia Rodrigo resonate with their generation. A 2019 poll by Ypulse found that for teenagers (13 to 18), the top musicians were Billie Eilish and Ariana Grande whereas among young adults (19 to 26), the most liked were Taylor Swift and Ariana Grande. Chinese music video app Musical.ly was highly popular among American teens. In 2018, Musical.ly was shut down and its users were transferred to TikTok. By the early 2020s, TikTok has become one of the most popular social networks among teenagers and young adults in the United States.
=== Vasodilation and increased permeability === As defined, acute inflammation is an immunovascular response to inflammatory stimuli, which can include infection or trauma. This means acute inflammation can be broadly divided into a vascular phase that occurs first, followed by a cellular phase involving immune cells (more specifically myeloid granulocytes in the acute setting). The vascular component of acute inflammation involves the movement of plasma fluid, containing important proteins such as fibrin and immunoglobulins (antibodies), into inflamed tissue. Upon contact with PAMPs, tissue macrophages and mastocytes release vasoactive amines such as histamine and serotonin, as well as eicosanoids such as prostaglandin E2 and leukotriene B4 to remodel the local vasculature. Macrophages and endothelial cells release nitric oxide. These mediators vasodilate and permeabilize the blood vessels, which results in the net distribution of blood plasma from the vessel into the tissue space. The increased collection of fluid into the tissue causes it to swell (edema). This exuded tissue fluid contains various antimicrobial mediators from the plasma such as complement, lysozyme, antibodies, which can immediately deal damage to microbes, and opsonise the microbes in preparation for the cellular phase. If the inflammatory stimulus is a lacerating wound, exuded platelets, coagulants, plasmin and kinins can clot the wounded area using vitamin K-dependent mechanisms and provide haemostasis in the first instance.
dihydrothymine dehydrogenase dihydrouracil dehydrogenase (NADP+) 4,5-dihydrothymine: oxidoreductase DPD DHPDH dehydrogenase, dihydrouracil (nicotinamide adenine dinucleotide, phosphate) DHU dehydrogenase hydropyrimidine dehydrogenase dihydropyrimidine dehydrogenase (NADP+)
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
==== Chemotaxis ==== Chemotaxis is the ability to direct movement through sensing a gradient of chemoattractants or chemorepellents using flagella, allowing bacteria to locate algal cells to lyse. Some algal cells can have intrinsic attractant properties, whereas others produce attractants. A common chemoattractant is dimethylsulfoniopropionate (DMSP). Additionally, chemotaxis allows for preferential "predation", as some organisms may prefer specific attractants. For instance, amino acids tend to be preferentially taken up by Polaribacter marinivivus and Lentibacter algarum, whereas nucleotides are preferentially taken up by Litoricola marina.
Sources: en.wikipedia.org
==== India ==== In India, glass noodles are called falooda (see falooda, the dessert dish), and are served on top of kulfi (a traditional ice cream). They are usually made from arrowroot starch using a traditional technique. The noodles have minimal flavor so they provide a nice contrast with the sweet kulfi. Kulfi and falooda can be bought from numerous food stalls throughout northern and southern parts of India.
The release of alarm pheromones near a hive may attract other bees to the location, where they will likewise exhibit defensive behaviors until there is no longer a threat, typically because the victim has either fled or been killed. (Note: A bee swarm, seen as a mass of bees flying or clumped together, is generally not hostile; it has deserted its hive and has no comb or young to defend.) These pheromones do not dissipate or wash off quickly, and if their target enters the water, bees will resume their attack as soon as it leaves the water. The alarm pheromone emitted when a bee stings another animal smells like a banana. Drone bees, the males, are larger and do not have stingers. The female bees (worker bees and queens) are the only ones that can sting, and their stinger is a modified ovipositor. The queen bee has a barbed but smoother stinger and can, if need be, sting skin-bearing creatures multiple times, but the queen does not leave the hive under normal conditions. Her sting is not for the defense of the hive; she only uses it for dispatching rival queens, ideally before they can emerge from their cells. Queen breeders who handle multiple queens and have the queen odor on their hands are sometimes stung by a queen. The stinger consists of three parts: a stylus and two barbed slides (or lancets), one on either side of the stylus. The bee does not push the stinger in but it is drawn in by the barbed slides.
Inherited – hereditary motor neuropathies, Charcot–Marie–Tooth disease, and hereditary neuropathy with liability to pressure palsy Acquired – diabetes mellitus, vascular neuropathy, alcohol use disorder, vitamin E deficiency, and vitamin B12 deficiency
When Noriega created the PDF in 1983, he brought into its control Panama's customs and immigration apparatus, as well as the country's whole transportation network. This expansion of the military's role occurred simultaneously with a large growth in the cocaine trade, as well as in markets for weapons in various military conflicts in Central America. The profits the military reaped from these activities gave Noriega's military regime considerable financial clout. Noriega took control of most major newspapers by either buying a controlling stake in them or forcing them to shut down. The government also harassed, intimidated, or exiled individual journalists and editors. The newspaper La Prensa, which remained independent and was frequently critical of Noriega, had its staff intimidated and its offices damaged; eventually, it too was forced to close. In May 1984, Noriega allowed the first presidential elections in 16 years. Noriega and Díaz Herrera picked Nicolás Ardito Barletta Vallarino to be the PRD's candidate, with the intention of keeping him under close control. When the initial results showed Arias, who had the support of much of the opposition, on his way to a landslide victory, Noriega halted the count. After brazenly manipulating the results, the government announced that Barletta had won by a slim margin of 1,713 votes. Independent estimates suggested that Arias would have won by as many as 50,000 votes had the election been conducted fairly. More than 60,000 votes were not included in the final count.
Sources: en.wikipedia.org
Lyophilization relies on sublimation, so water moves from solid ice to vapor without becoming liquid. The material is frozen, pressure is reduced, and controlled heat is supplied. Vapor is captured on a cold condenser, leaving a dry porous solid.
The process has three main stages: freezing, primary drying, and secondary drying. Freezing sets the ice structure, primary drying removes free ice, and secondary drying removes bound water. Each stage uses specific temperature, pressure, and time settings.
No, it is a drying method rather than a sterilization method. Removing water can limit microbial growth, but it does not reliably kill microorganisms. Sterility must come from separate steps such as filtration, heat treatment, or aseptic processing.
Primary drying removes ice by sublimation under vacuum. Secondary drying removes water that is bound to the material, often by warming the product after most ice has left. Both stages occur below temperatures that would cause unwanted melting.