A practical reference on sublimation: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-01-13. Anything still debated is marked as such rather than presented as settled.
Lyophilization, or freeze-drying, removes water from a material by freezing it and then lowering pressure so ice changes directly to vapor. The process relies on sublimation, the phase transition from solid to gas without an intervening liquid state. It is used for heat-sensitive materials that would degrade in conventional drying. The three stages are freezing, primary drying, and secondary drying, each with distinct temperature and pressure requirements. In practice, cycle design balances these variables.
Freezing determines ice crystal structure and pore size, which affect drying speed and product uniformity. Rapid freezing creates small crystals, while slow freezing creates larger crystals and often faster sublimation. During primary drying, chamber pressure is held below the vapor pressure of ice, and shelf temperature supplies heat for sublimation. The ice front recedes, leaving a porous matrix. Thermal limits such as collapse and eutectic temperatures set safe boundaries for formulation. These limits vary with solute composition and concentration.
The process generally proceeds in three stages: freezing, primary drying, and secondary drying. During freezing, controlled cooling converts water into ice and may also crystallize or vitrify solutes. In primary drying, the pressure is lowered below the triple point, and heat is supplied so ice sublimes directly to vapor. Secondary drying removes water that remains bound to the solid matrix, yielding a low final water content. Product temperature must stay below the collapse or glass transition temperature to maintain structure. Cycle design therefore balances shelf temperature, chamber pressure, and time.
Freeze-drying is used for materials whose activity or structure depends on low temperature and low water content. Examples include certain biologics, diagnostic reagents, starter cultures, coffee, and porous inorganic precursors. The dried product forms a cake whose porosity aids rapid wetting and dissolution. Main drawbacks are high energy use, long cycle times, and sensitivity to formulation and equipment variation. Questions remain about how freezing rates and ice morphology affect batch uniformity, especially when moving from laboratory to production scale.
Lyophilization, also called freeze-drying, is a dehydration process in which a solvent, usually water, is frozen and then removed by sublimation under reduced pressure. The method preserves heat-sensitive materials that would degrade in conventional drying. Large-scale use grew during the mid-twentieth century for blood plasma and antibiotics, and it later expanded to vaccines, enzymes, foods, and advanced materials. The process produces a dry, porous solid that usually reconstitutes rapidly. It is distinct from simple evaporation because the solvent bypasses the liquid phase during primary removal.
| Property | Value | Notes |
|---|---|---|
| Process name | Lyophilization or freeze-drying | Both terms appear in technical standards and literature. |
| Phase transition | Sublimation | Solid ice becomes vapor without a liquid step. |
| Typical chamber pressure | 0.05-0.5 mbar | Range depends on product temperature and equipment. |
| Typical product temperature | -40 °C to -10 °C | Measured during primary drying; formulation sets limits. |
| Water content after drying | 0.5-3% w/w | Target varies by material and stability needs. |
Equipment for lyophilization includes a vacuum chamber, temperature-controlled shelves, a condenser, and a vacuum pump. A refrigeration system cools the shelves and condenser below the product's freezing point. Process monitoring often uses Pirani and capacitance manometers, thermocouples, and resistance sensors. Cycle development balances product quality with time and energy use. Some products are annealed during freezing to improve crystallization of bulking agents. Open questions remain about scaling cycles between laboratory, pilot, and production freeze-dryers.
Lyophilization, also called freeze-drying, removes water from a frozen material by sublimation under reduced pressure. The process begins with freezing, which converts free water into ice and may also produce a glassy phase. Primary drying then lowers chamber pressure so ice sublimes directly to vapor without passing through a liquid stage. Secondary drying raises the temperature modestly to remove bound water. The result is a porous, dry solid that usually reconstitutes quickly. Each stage influences pore structure, residual moisture, and stability.
The physics of lyophilization depends on phase boundaries and heat and mass transfer. During primary drying, heat supplied to the product must equal the latent heat of sublimation, while water vapor moves through the drying cake to the condenser. If shelf temperature or pressure is set too high, the ice front can exceed the collapse temperature, causing meltback or pore collapse. If conditions are too cold, drying slows and costs rise. Formulation excipients, vial geometry, and freezing rate alter these limits.
The physical chemistry of freezing influences whether a formulation forms an amorphous glass or a crystalline solid. Amorphous systems can collapse if product temperature rises above the glass transition temperature of the freeze concentrate. Crystalline systems may show eutectic melting, where ice and solute melt together at a fixed temperature. Formulators add bulking agents, lyoprotectants, and buffers to preserve structure and biological activity. The optimum cycle keeps product temperature below critical thresholds during primary drying while allowing efficient sublimation.
Lyophilization is a dehydration process that removes water from a frozen material by sublimation under low pressure. The material is first frozen so that water becomes ice; then the surrounding pressure is lowered below the vapor pressure of ice. Heat is applied gently so ice changes directly to vapor without passing through a bulk liquid phase. The vapor is collected on a cold condenser, leaving a dry porous matrix. This process differs from simple evaporation because the material remains frozen during the main drying stage.
The process relies on the phase diagram of water, where the triple point marks the conditions at which ice, liquid water, and vapor coexist. By maintaining pressure below this point, typically around 0.01 to 0.1 millibar, sublimation becomes the dominant mechanism. Formulations often include excipients such as sugars or polymers that act as lyoprotectants and bulking agents. These additives help preserve the structure of the active ingredient and prevent collapse during drying. The choice of excipient and freezing rate influences the final cake morphology and stability.
Industries use lyophilization for pharmaceuticals, biological products, and food preservation. In the pharmaceutical sector, it extends the shelf life of injectable drugs, vaccines, and proteins that are unstable in aqueous solution. Food manufacturers apply freeze-drying to coffee, fruits, and ready meals to retain flavor and texture. The process is energy-intensive and requires specialized equipment, which limits its use to high-value products. Ongoing research examines how formulation and process parameters affect the quality of the final dried product.
Lyophilization, also known as freeze-drying, is a process that removes water from a material by freezing it and then reducing pressure to allow ice to sublimate directly into vapor. The method begins with a freezing step that solidifies the water content. Next, primary drying lowers the pressure below the triple point of water, enabling sublimation without passing through a liquid phase. A final secondary drying step removes bound water through desorption. This sequence produces a dry, porous cake that can be reconstituted later.
Lyophilization is a dehydration technique in which a product is frozen and the solvent is removed under reduced pressure. The low pressure allows ice to sublimate directly into vapor without passing through a bulk liquid phase. This differs from conventional drying, where heat drives evaporation and can damage heat-sensitive structures. The process is used for biological materials, pharmaceutical formulations, and some foods. Its main advantage is preservation of porous structure and rapid reconstitution.
Freezing is the first stage and sets the ice structure that later becomes the pore network. The formulation is cooled below its freezing point, often with a controlled ramp, and solutes concentrate as ice forms. Primary drying then lowers chamber pressure and supplies heat to sublime the ice. The product temperature must stay below its collapse or eutectic temperature to prevent structural loss. Secondary drying raises the temperature modestly to remove bound water and achieve a low residual moisture.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
=== Structure-activity experiments === When the 12-amino acid sequence of 'peptide 3'/CCL2 is aligned with the sequences of the other chemokines CCL3, CXCL8 and CXCL12 5 amino acids are conserved, Cys3, Asp5, Pro6, Trp10 and Gln12. In addition Val11 is also present in CCL3 and CXCL8. The corresponding 11th amino acid in CXCL12 is Ile. Ala4 in CCL2 is also present in CCL3 but the corresponding residue is Leu in CXCL8 and Ile in CXCL12. Inclusion of Leu at position 4 and Ile at position 11 (NH2-EICLDPKQKWIQ-OH) increased the inhibition potency of the peptide to 2-4μM. Removal of the first two residues from 'Peptide 3' (NH2-CADPKQKWVQ-OH) does not lower its BSCI potency. Peptide 3-Leu4, Ile11, the most potent BSCI peptide was chosen for further development. The first two amino acids were removed, and then according to the method of Jameson et al., the amino acid sequence was reversed and the amino acids replaced with D-amino acids. This combined transformation changes the orientation of the amides in the backbone but does not change the position of the amino acid sidechains. The peptide was then cyclised by adding a cysteine to the other end (HO-CLDPKQKWIQC-NH2), and oxidisation to form a disulfide bond to give NR58,3-14-3.
=== Theatres, auditoriums and concerts === There are two main cultural axes in Le Havre: the central city and the Eure district. The Espace Oscar Niemeyer consists of a part of the "Great Volcano", a national theatre seating 1,093 (which houses the National Choreographic Centre of Le Havre Haute-Normandie directed by Hervé Robbe) and secondly the "Little Volcano" with a 250-seat multi-purpose hall for live performances. The whole Espace Oscar Niemeyer has been worked on since 2011: the little volcano will be transformed into a multimedia library. As for the performances at the Great Volcano, they are now taking place in the old ferry terminal until the end of construction. Other cultural institutions of the city centre are being transformed: the cinema of art and a trial of Le Sirius facing the university will reopen in 2013. Le Tetris at the fort of Tourneville will, in 2013, be a place devoted to contemporary music. Other cultural venues are scattered in the city centre: the cinema Le Studio, the theatre of the City Hall (700 seats), the Little Theatre (450 seats), the Théâtre des Bains Douches (94 seats), Akté theatre (60 seats), and the Poulailler (Henhouse)) (associative theatre with 50 seats) host numerous shows each year. The National Choreographic Centre of Le Havre Haute-Normandie specialises in the creation and production of dance shows. Other shows and performances are given in other places and at the Conservatory Arthur Honegger. The second cultural centre of the city is in the Eure district near the Basin Vauban.
"p53 Knowledgebase". Lane Group at the Institute of Molecular and Cell Biology (IMCB), Singapore. Archived from the original on 2006-01-03. Retrieved 2008-04-06. GeneReviews/NCBI/NIH/UW entry on Li-Fraumeni Syndrome TUMOR PROTEIN p53 @ OMIM p53 restoration of function p53 @ The Atlas of Genetics and Cytogenetics in Oncology and Haematology TP53 Gene @ GeneCards p53 News provided by insciences organisation Goodsel DS (2002-07-01). "p53 Tumor Suppressor". Molecule of the Month. RCSB Protein Data Bank. Retrieved 2008-04-06. Soussi T. "p53 Web Site". Retrieved 2008-04-06. Living LFS A non-profit Li-Fraumeni Syndrome patient support organization The George Pantziarka TP53 Trust A support group from the UK for people with Li-Fraumeni Syndrome or other TP53-related disorders IARC TP53 Somatic Mutations database maintained at IARC, Lyon, by Magali Olivier PDBe-KB provides an overview of all the structure information available in the PDB for Human P53. scientific animation conformational changes of p53 upon binding to DNA
Sources: en.wikipedia.org
== Further reading == Kropotkin, Peter Alexeivitch; Bealby, John Thomas (1911). "Don Cossacks, Territory of the" . Encyclopædia Britannica. Vol. 8 (11th ed.). p. 412. Peter Holquist, "'Conduct Merciless Mass Terror': Decossackization on the Don, 1919," Cahiers du Monde russe, vol. 38, no. 1/2(Jan.-June 1997), pp. 127–162. In JSTOR Noël Bonneuil, Elena Fursa. 2020. "Nuptiality to regulate the commons? The case of the Don Cossacks (South Russia), 1867–1916." Oxford Economic Papers
For example, horseradish peroxidase can use a variety of organic compounds as electron donors and acceptors. Horseradish peroxidase has an accessible active site, and many compounds can reach the site of the reaction. On the other hand, for an enzyme such as cytochrome c peroxidase, the compounds that donate electrons are very specific, due to a very narrow active site.
Electrochemotherapy is the combined treatment in which injection of a chemotherapeutic drug is followed by application of high-voltage electric pulses locally to the tumor. The treatment enables the chemotherapeutic drugs, which otherwise cannot or hardly go through the membrane of cells (such as bleomycin and cisplatin), to enter the cancer cells. Hence, greater effectiveness of antitumor treatment is achieved. Clinical electrochemotherapy has been successfully used for treatment of cutaneous and subcutaneous tumors irrespective of their histological origin. The method has been reported as safe, simple and highly effective in all reports on clinical use of electrochemotherapy. According to the ESOPE project (European Standard Operating Procedures of Electrochemotherapy), the Standard Operating Procedures (SOP) for electrochemotherapy were prepared, based on the experience of the leading European cancer centres on electrochemotherapy. Recently, new electrochemotherapy modalities have been developed for treatment of internal tumors using surgical procedures, endoscopic routes or percutaneous approaches to gain access to the treatment area.
The most important drugs with a dipeptide (L-alanyl-L-proline) moiety are the "-pril" cardiovascular drugs, such as Alapril (lisinopril), Captoril (captopril), Novolac (imidapril) and Renitec (enalapril). The artificial sweetener Aspartame (N-L-α-Aspartyl-L-phenylalanine 1-methyl ester) is also a dipeptide. At the high end, there is the anticoagulant hirudin, MW ≈ 7000, which is composed of 65 amino acids. Apart from pharmaceuticals, peptides are also used for diagnostics and vaccines. The total production volume (excluding Aspartame) of chemically synthesized, pure peptides is about 1,500 kg (3,300 lb) and sales approach $500 million on the active pharmaceutical (API) level and $10 billion on the finished drug level, respectively. The bulk of the production of peptide drugs, which also include the first generation anti-AIDS drugs, the "...navirs", is outsourced to a few specialized contract manufacturers, such as Bachem, Switzerland; Chengu GT Biochem, China; Chinese Peptide Company, China; Lonza, Switzerland, and Polypeptide, Denmark. Proteins are "very high-molecular-weight" (MW > 100,000) organic compounds, consisting of amino acid sequences linked by peptide bonds. They are essential to the structure and function of all living cells and viruses and are among the most actively studied molecules in biochemistry. They can be made only by advanced biotechnological processes; primarily mammalian cell cultures. Monoclonal antibodies (mAb) prevail among human-made proteins. About a dozen of them are approved as pharmaceuticals.
The endomysium, meaning within the muscle, is a wispy layer of areolar connective tissue that ensheaths each individual muscle fiber, or muscle cell. It also contains capillaries and nerves. It overlies the muscle fiber's cell membrane: the sarcolemma. Endomysium is the deepest and smallest component of muscle connective tissue. This thin layer helps provide an appropriate chemical environment for the exchange of calcium, sodium, and potassium, which is essential for the excitation and subsequent contraction of a muscle fiber. Endomysium combines with perimysium and epimysium to create the collagen fibers of tendons, providing the tissue connection between muscles and bones by indirect attachment. It connects with perimysium using intermittent perimysial junction plates. Collagen is the major protein that composes connective tissues like endomysium. Endomysium has been shown to contain mainly type I and type III collagen components, and type IV and type V in very minor amounts. Others have found type IV and type V more common. The term cardiac skeleton is sometimes considered synonymous with endomysium in the heart, but cardiac skeleton also refers to the combination of the endomysium and perimysium.
Sources: en.wikipedia.org
== Dietary sources == Good sources of phenylalanine are eggs, chicken, liver, beef, milk, and soybeans. Another common source of phenylalanine is anything sweetened with the artificial sweetener aspartame, such as diet drinks, diet foods and medication; the metabolism of aspartame produces phenylalanine as one of the compound's metabolites.
Thépegnier thought that the influences on the band's sound in general, and that on 2025's Saddiction, were probably a combination of their aggressive hardcore punk background and a strong interest in UK post-punk, as well as in cold wave and new wave, which produce "cold sounds and textures". A Loner and Saddiction were sonically influenced by post-punk and cold wave. Chanut and Toufouti also cited Chris Cornell and Dax Riggs as musical and artistic inspirations. The group cited the works of authors such as Baudelaire, Camus, and Céline, as well as true crime stories and French magazines such as Le Nouveau Détective (lit. 'The New Detective') and L'Œil de la police (lit. 'The Eye of the Police') among their thematic influences. They also cited Apocalypse Culture as an influence. They drew inspiration from period films, which led to the samples used in their music. The David Lynch-style ambiences and the film Dead Man also inspired their interludes. The French film score composer François de Roubaix was cited by the group as an important source of inspiration. In addition, documentaries such as Black Tar Heroin, Cut Up Kids, [Jon Alpert's] Dope Sick Love, Streetwise and Whores' Glory influenced them.
Machine learning uses both discriminative models and generative models to predict or generate data. Beginning in the late 2000s and early 2010s, advances in deep learning led to major improvements in image classification, speech recognition, and natural language processing. Neural networks in this period were typically trained as discriminative models due to the relative difficulty of training generative models. In 2014, the introduction of models such as the variational autoencoder (VAE) and generative adversarial network (GAN) enabled effective deep generative modeling of complex data such as images. In 2017, the paper "Attention Is All You Need" proposed that transformer architecture could enable further advances in generative modeling compared to earlier long short-term memory (LSTM) networks. This led to the development of generative pre-trained transformer (GPT) models, beginning with GPT-1 in 2018.
The large intestine contains multiple types of bacteria, and other microorganisms that can break down molecules the human body cannot process alone, demonstrating a symbiotic relationship. These microbes are responsible for gas production at host–pathogen interface, which is released as flatulence. Intestinal bacteria can also participate in biosynthesis reactions. For example, certain strains in the large intestine produce vitamin B12; an essential compound in humans for things like DNA synthesis and red blood cell production. However, the primary function of the large intestine is water absorption from digested material (regulated by the hypothalamus) and the reabsorption of sodium and nutrients. Beneficial intestinal bacteria compete with potentially harmful bacteria for space and nutrients, as the intestinal tract has limited resources. A ratio of 80–85% beneficial to 15–20% potentially harmful bacteria is proposed for maintaining homeostasis. An imbalanced ratio results in dysbiosis.
Membrane lipids: Phospholipids: Phospholipids are a major component of the lipid bilayer of the cell membrane and are found in many parts of the body. Sphingolipids: Sphingolipids are mostly found in the cell membrane of neural tissue. Glycolipids: The main role of glycolipids is to maintain lipid bilayer stability and facilitate cell recognition. Glycerophospholipids: Neural tissue (including the brain) contains high amounts of glycerophospholipids. Other types of lipids: Cholesterol: Cholesterol is the main precursor for different hormones in our body such as progesterone and testosterone. The main function of cholesterol is controlling the cell membrane fluidity. Steroid – see also steroidogenesis: Steroids are one of the important cell signaling molecules. Triacylglycerols (fats) – see also lipolysis and lipogenesis: Triacylglycerols are the major form of energy storage in human body. Fatty acids – see also fatty acid metabolism: Fatty acids are one of the precursors used for lipid membrane and cholesterol biosynthesis. They are also used for energy. Bile salts: Bile salts are secreted from liver and they facilitate lipid digestion in the small intestine. Eicosanoids: Eicosanoids are made from fatty acids in the body and they are used for cell signaling. Ketone bodies: Ketone bodies are made from fatty acids in the liver. Their function is to produce energy during periods of starvation or low food intake.
Sources: en.wikipedia.org
Conventional drying uses heat to evaporate liquid water, often at temperatures that can degrade sensitive materials. Lyophilization freezes the material first and then removes water by sublimation under vacuum. This avoids prolonged exposure to liquid water and high heat.
Lowering pressure reduces the boiling point of water and allows ice to sublimate at temperatures below freezing. Vacuum also limits convective heat transfer, so heat is usually supplied by shelves or radiation. The pressure must stay below the vapor pressure of ice at the product temperature.
The cycle typically includes freezing, primary drying, and secondary drying. Freezing solidifies water and sets the pore structure; primary drying removes bulk ice; secondary drying removes bound water. Some cycles add annealing or pre-freezing steps.
Yes. Lyophilization and freeze-drying are synonyms for the same vacuum-assisted sublimation process. The term lyophilization is more common in pharmaceutical and laboratory settings, while freeze-drying is widely used in food and general contexts.